WH0005026M1

Monoclonal Anti-P2RX5 antibody produced in mouse

clone 1C5, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-MGC47755, Anti-P2X5, Anti-P2X5R, Anti-purinergic receptor P2X, ligand-gated ion channel, 5
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1C5, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: NM_002561
• UniProt 수납 번호: Q93086
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... P2RX5(5026)

설명

일반 설명

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)

면역원

P2RX5 (NP_002552, 126 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP

생화학적/생리학적 작용

P2RX5 (Purinergic receptor P2X, ligand-gated ion channel, 5) functions as a ATP-gated ion channel. In humans, it is predicted to form trimeric structure with another member of this family, P2X1. Upregulated P2RX5 expression has been observed during CD4⁺ T cell activation. It has been studied that activated P2RX5 plays an important role in the T cell polarity and immunoregulation, when it is recruited to the surface of the activated CD4⁺ T cells.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)