WH0004711M1

Monoclonal Anti-NDUFB5 antibody produced in mouse

clone 5G5, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CISGDH, Anti-DKFZp686N02262, Anti-FLJ30597, Anti-MGC111204, Anti-MGC12314, Anti-NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa, Anti-SGDH
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 클론: 5G5, monoclonal
• application: ELISA (i); WB
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 5G5, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: NM_002492
• UniProt 수납 번호: O43674
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NDUFB5(4711)

설명

일반 설명

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. (provided by RefSeq)

면역원

NDUFB5 (NP_002483, 95 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)