WH0004005M1

Monoclonal Anti-LMO2 antibody produced in mouse

clone 6B8, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-LIM domain only 2 (rhombotin-like 1), Anti-RBTN2, Anti-RBTNL1, Anti-RHOM2, Anti-TTG2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 6B8, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: BC034041
• UniProt 수납 번호: P25791
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... LMO2(4005)

설명

일반 설명

LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms

면역원

LMO2 (AAH34041, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRPFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)