WH0002697M1

Monoclonal Anti-GJA1 antibody produced in mouse

clone 3E5, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CX43, Anti-DFNB38, Anti-GJAL, Anti-ODD, Anti-ODDD, Anti-ODOD, Anti-SDTY3, Anti-gap junction protein, alpha 1, 43kDa (connexin 43)
• MDL number: MFCD00803532
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: ELISA (i); WB
• 클론: 3E5, monoclonal
• 종 반응성: human
• citations: 6
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3E5, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: BC026329
• UniProt 수납 번호: P17302
• 배송 상태: dry ice
• 저장 온도: −20°C
• 유전자 정보: human ... GJA1(2697)

설명

일반 설명

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia and heart malformations. (provided by RefSeq)

면역원

GJA1 (AAH26329, 261 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD*

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)