WH0002597M1

Anti-GAPDH Antibody

mouse monoclonal, 3C2

• 동의어(들): Anti-G3PD, Anti-GAPD, Anti-MGC88685, Anti-glyceraldehyde-3-phosphate dehydrogenase
• MDL number: MFCD01322099
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• product name: Monoclonal Anti-GAPDH antibody produced in mouse, clone 3C2, purified immunoglobulin, buffered aqueous solution
• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3C2, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: NM_002046
• UniProt 수납 번호: P04406
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GAPDH(2597)

설명

일반 설명

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), a classic glycolytic enzyme, is a multi-functional protein. It is mainly present in the cytoplasm. GAPDH is ubiquitously expressed. The GAPDH gene is located on human chromosome 12.

The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. (provided by RefSeq)

면역원

GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

애플리케이션

Monoclonal Anti-GAPDH antibody produced in mouse has been used in western blot, (1:5000), and (1:2,000).

생화학적/생리학적 작용

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) participates in energy metabolism. It might have extra glycolytic roles in DNA repair. GAPDH plays a key role in glycolysis and several non-glycolytic actions. GAPDH binds to microtubules and regulates microtubule bundling and aids in membrane fusion. GAPDH participates in gene transcription, DNA replication, and nuclear RNA export. GAPDH acts as a uracil DNA glycosylase (UDG) that plays a role in DNA repair. It also acts as a mediator for cell death. GAPDH may play a role in Alzheimer′s disease (AD). It can be a potential therapeutic target in chemotherapy. Overexpression of the GAPDH gene in the T cell lineage is associated with angioimmunoblastic T cell lymphoma.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)