추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
1E5, monoclonal
양식
buffered aqueous solution
종 반응성
human
기술
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... FAP(2191)
일반 설명
Fibroblast activation protein (FAP), a cell-surface type II transmembrane glycoprotein serine protease, has a cytoplasmic tail, a single transmembrane domain, and an extracellular domain. It is a member of the S9b family of post-proline cleaving enzymes. FAP is localized in the plasma membrane. FAP gene is mapped to human chromosome 2q24.2. Expression of FAP is hardly seen in adult tissues.
면역원
FAP (AAH26250, 525 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS
Sequence
PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS
애플리케이션
Monoclonal Anti-FAP antibody produced in mouse has been used in western blotting.
생화학적/생리학적 작용
Fibroblast activation protein (FAP) participates in the remodeling of tissue, wound healing, inflammation, fibrosis, and tumor development. It possesses dipeptidyl peptidase and endopeptidase activities. FAP plays a key role in the remodeling of extracellular matrix structure and the reconstruction of tumor microarray. Overexpression of the FAP gene might return epithelial ovarian cancer after chemotherapy. FAP gene expression is involved in cancer cells and premalignant metaplastic cells of the esophagus.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Min Li et al.
BMC cancer, 20(1), 1032-1032 (2020-10-29)
High-grade serous ovarian cancer (HGSOC) is a fatal form of ovarian cancer. Previous studies indicated some potential biomarkers for clinical evaluation of HGSOC prognosis. However, there is a lack of systematic analysis of different expression genes (DEGs) to screen and
FAP (fibroblast activation protein alpha)
Tuncer S and Banerjee S
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2020)
Xin Maggie Wang et al.
Frontiers in bioscience : a journal and virtual library, 13, 3168-3180 (2007-11-06)
Fibroblast activation protein (FAP) is the member of Dipeptidyl Peptidase IV (DPIV) gene family that is most similar to DPIV. Four members of this family, DPIV, FAP, DP8 and DP9 possess a rare catalytic activity, hydrolysis of a prolyl bond
Hannelore Denys et al.
Cancer letters, 266(2), 263-274 (2008-04-22)
Several studies indicate that cancer-associated fibroblasts play a critical role in cancer cell invasion and metastasis, the hallmarks of malignancy. To better understand the mechanisms underlying such effects, we established a heterotypic model of human fibroblasts (primary colon fibroblasts and
Youfei Li et al.
The International journal of developmental biology, 58(5), 349-353 (2014-10-31)
Preeclampsia is a severe pregnancy complication in part due to insufficient implantation. This study aimed at elucidating the mechanism of action of dipeptidyl peptidase IV (DPPIV) in preeclampsia. Small activating RNAs (saRNA) were used to upregulate DPPIV expression in human
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.