WH0001268M1

Monoclonal Anti-CNR1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CANN6, Anti-CB1, Anti-CB1A, Anti-CB1K5, Anti-CBR, Anti-CNR, Anti-cannabinoid receptor 1 (brain)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2F9, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2bκ
• GenBank 수납 번호: NM_016083
• UniProt 수납 번호: P21554
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CNR1(1268)

설명

일반 설명

Cannabinoid receptor 1 (CNR1) also known as the type-1 cannabinoid receptor (CB1), is encoded by the gene mapped to human chromosome 6q15. The encoded protein is a member of the class A G protein-coupled receptor (GPCR) family and is highly expressed in the brain and the central nervous system.

This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. (provided by RefSeq)

면역원

CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV

생화학적/생리학적 작용

Cannabinoid receptor 1 (CNR1) plays a key role in regulation of the endocannabinoid system (ECS), which is involved in most of the activities of the brain and body. Mutations in the gene has been associated with the development of hebephrenic schizophrenia. Experimental studies hypothesize that aberrations in CNR1 gene increases the risk of susceptibility to substance abuse.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)