콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

WH0001268M1

Sigma-Aldrich

Monoclonal Anti-CNR1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-CANN6, Anti-CB1, Anti-CB1A, Anti-CB1K5, Anti-CBR, Anti-CNR, Anti-cannabinoid receptor 1 (brain)

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

2F9, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

indirect ELISA: suitable
western blot: 1-5 μg/mL

동형

IgG2bκ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... CNR1(1268)

일반 설명

Cannabinoid receptor 1 (CNR1) also known as the type-1 cannabinoid receptor (CB1), is encoded by the gene mapped to human chromosome 6q15. The encoded protein is a member of the class A G protein-coupled receptor (GPCR) family and is highly expressed in the brain and the central nervous system.
This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. (provided by RefSeq)

면역원

CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV

생화학적/생리학적 작용

Cannabinoid receptor 1 (CNR1) plays a key role in regulation of the endocannabinoid system (ECS), which is involved in most of the activities of the brain and body. Mutations in the gene has been associated with the development of hebephrenic schizophrenia. Experimental studies hypothesize that aberrations in CNR1 gene increases the risk of susceptibility to substance abuse.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

The incentive salience of alcohol: translating the effects of genetic variant in CNR1.
Hutchison KE
Archives of General Psychiatry, 65, 841-850 (2008)
Cannabinoid receptor gene (CNR1): association with i.v. drug use.
Comings DE
Molecular Psychiatry, 2, 161-168 (1997)
The CB1 Receptor as the Cornerstone of Exostasis.
Piazza PV
Neuron, 93, 1252-1274 (2017)
CNR1, central cannabinoid receptor gene, associated with susceptibility to hebephrenic schizophrenia.
Ujike H
Molecular Psychiatry, 7, 515-518 (2002)
Crystal Structure of the Human Cannabinoid Receptor CB1.
Hua T
Cell, 167, 750-762 (2016)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.