WH0000975M1

Monoclonal Anti-CD81 antibody produced in mouse

clone 2B7, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CD81 antigen (target of antiproliferative antibody 1), Anti-S5.7, Anti-TAPA1, Anti-TSPAN28
• MDL number: MFCD01633235
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2B7, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG1κ
• GenBank 수납 번호: BC002978
• UniProt 수납 번호: P60033
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CD81(975)

설명

일반 설명

Cluster of differentiation 81(CD81), also known as target of antiproliferative antibody 1 (TAPA-1), is encoded by the gene mapped to human chromosome 11p15.5. The encoded protein belongs to the tetraspanin family and is mainly expressed on the oocyte surface. CD81 is characterized with a five large helical segments.

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. (provided by RefSeq)

면역원

CD81 (AAH02978, 25 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY

생화학적/생리학적 작용

Cluster of differentiation 81 (CD81) has a role in membrane organization, cell-cell interactions, cellular fusion and protein trafficking. It is also implicated in receptor clustering and signaling. CD81 acts as a putative receptor for hepatitis C virus (HCV) and facilitates the HCV glycoprotein-dependent viral cell entry. Elevated expression of the gene has been observed in various types of cancers.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)