WH0000653M2

Monoclonal Anti-BMP5 antibody produced in mouse

clone 1C1, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-Bone Morphogenetic Protein 5, Anti-MGC34244
• MDL number: MFCD01864602
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1C1, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2bκ
• GenBank 수납 번호: NM_021073.1
• UniProt 수납 번호: P22003
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... BMP5(653)

설명

일반 설명

This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. (provided by RefSeq)

면역원

BMP5 (NP_066551.1, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)