SAB5702838

Anti-KMT1B / SUV39H2 Antibody, clone 6L2D9, Rabbit Monoclonal

• 동의어(들): KMT1B
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 6L2D9, monoclonal
• 형태: liquid
• 분자량: 47 kDa
• 종 반응성: human
• 농도: 1.25 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: ESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
• UniProt 수납 번호: Q9H5I1
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SUV39H2(79723)

설명

일반 설명

Histone methyltransferase that specifically trimethylates ′Lys-9′ of histone H3 using monomethylated H3 ′Lys-9′ as substrate. H3 ′Lys-9′ trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5 proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 ′Lys-9′ trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher-order chromatin organization during spermatogenesis. Recruited by the large PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1, contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 ′Lys-9′ trimethylation.

면역원

A synthetic peptide corresponding to a sequence within amino acids 311-410 of human KMT1B / SUV39H2 (Q9H5I1).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1