SAB5702746

Anti-ILF2 Antibody, clone 5P1K2, Rabbit Monoclonal

• 동의어(들): NF45, PRO3063
• UNSPSC 코드: 12352203
• NACRES: NA.46
• 클론: 5P1K2, monoclonal
• application: IHC; WB
• 종 반응성: human, rat, rat
• 기술: immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 5P1K2, monoclonal
• 양식: liquid
• 분자량: 43 kDa
• 종 반응성: human, rat, rat
• 농도: 0.80 mg/mL
• 기술: immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: SALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHT
• UniProt 수납 번호: Q12905
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ILF2(3608)

설명

일반 설명

The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. [provided by RefSeq, Dec 2014]

면역원

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ILF2 (Q12905).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB, IHC

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1