SAB5702707

Anti-Nectin 2/CD112 Antibody, clone 3H0G2, Rabbit Monoclonal

• 동의어(들): CD112, HVEB, PRR2, PVRL2, PVRR2
• UNSPSC 코드: 12352203

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 3H0G2, monoclonal
• 형태: liquid
• 분자량: 72 kDa
• 종 반응성: human, rat, rat
• 농도: 0.42 mg/mL
• 기술: immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: TPKAKLEAQEMPSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
• UniProt 수납 번호: Q92692
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NECTIN2(5819)

설명

일반 설명

This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

면역원

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 410-538 of human Nectin 2/CD112 (Q92692).

애플리케이션

WB, IHC

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1