SAB5702408

Anti-IL13RA1 Antibody, clone 5A3W5, Rabbit Monoclonal

• 동의어(들): CD213A1, CT19, IL-13Ra, NR4
• UNSPSC 코드: 12352203

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 5A3W5, monoclonal
• 형태: liquid
• 분자량: 49 kDa
• 종 반응성: human
• 농도: 0.5 mg/mL
• 기술: immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGS
• UniProt 수납 번호: P78552
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... IL13RA1(3597)

설명

일반 설명

The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4. [provided by RefSeq, Jul 2008]

면역원

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL13RA1 (P78552).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB, IHC

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1