SAB5702371

Anti-HTRA2 Antibody, clone 4H8C4, Rabbit Monoclonal

• 동의어(들): MGCA8, OMI, PARK13, PRSS25
• UNSPSC 코드: 12352203

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 4H8C4, monoclonal
• 형태: liquid
• 분자량: 36 kDa
• 종 반응성: rat, human, rat
• 농도: 0.48 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: GTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVV
• UniProt 수납 번호: O43464
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... HTRA2(27429)

설명

일반 설명

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]

면역원

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HTRA2 (O43464).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1