SAB5702119

Anti-Presenilin 1 Antibody, clone 3W4V8, Rabbit Monoclonal

• 동의어(들): AD3,FAD,PS-1,PS1,S182,Presenilin 1,PSEN1
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 3W4V8, monoclonal
• 양식: liquid
• 종 반응성: rat, human, rat
• 농도: 1.05 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATI
• UniProt 수납 번호: P49768
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PSEN1(5663)

설명

일반 설명

Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene, the full-length nature of only some have been determined. [provided by RefSeq, Aug 2008]

면역원

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Presenilin 1 (P49768).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1