SAB2109088

Anti-INHBA (N-terminal) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): EDF, FRP
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 44 kDa
• 종 반응성: rat
• 종 반응성(상동성에 의해 예측): human, canine, sheep, goat, horse, bovine, mouse, rabbit, pig
• 농도: 0.5 mg/mL
• 기술: western blot: 1 μg/mL
• NCBI 수납 번호: NM_002192
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... INHBA(57396)

설명

일반 설명

The inhibin beta A subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta A subunit forms a homodimer, activin A, and also joins with a beta B subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. Finally, it has been shown that the beta A subunit mRNA is identical to the erythroid differentiation factor subunit mRNA and that only one gene for this mRNA exists in the human genome.

면역원

Synthetic peptide directed towards the N terminal region of human INHBA

서열

Synthetic peptide located within the following region: CPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALL

물리적 형태

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable