SAB2108881

Anti-EGFLAM (C-terminal) antibody produced in rabbit HRP conjugated

affinity isolated antibody

• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• 결합: peroxidase conjugate
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 41 kDa
• 종 반응성(상동성에 의해 예측): human, rat, horse, canine, rabbit, mouse, guinea pig, bovine
• 농도: 0.5 mg/mL
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... EGFLAM(133584)

설명

일반 설명

EGFLAM is involved in both the retinal photoreceptor ribbon synapse formation and physiological functions of visual perception. It is necessary for proper bipolar dendritic tip apposition to the photoreceptor ribbon synapse and promotes matrix assembly and cell adhesiveness.

면역원

Synthetic peptide directed towards the C-terminal region of Human EGFLAM

서열

Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS

물리적 형태

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable