콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

SAB2108342

Sigma-Aldrich

Anti-SGK1 antibody produced in rabbit

affinity isolated antibody

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

49kDa

종 반응성

guinea pig, rabbit, bovine, human, mouse, rat, dog, horse

농도

0.5 mg - 1 mg/mL

기술

immunoblotting: suitable
immunohistochemistry: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SGK1(6446)

일반 설명

SGK1 (serum/glucocorticoid regulated kinase 1) codes for a serine/threonine kinase and it is structurally and functionally homologous to kinases of AKT (protein kinase B) family. SGK1 is ubiquitously expressed in all tissues and is predominant in kidney. The SKG1 gene is mapped to human chromosome 6q23.2.

면역원

Synthetic peptide directed towards the N terminal region of human SGK1

생화학적/생리학적 작용

The SGK1 (serum/glucocorticoid regulated kinase 1) gene is associated with a number of pathophysiological processes such as autophagy, ion transport, proliferation, metabolic, inflammation, syndrome and endoplasmic reticulum stress. Cellular dehydration, increased extracellular salt concentration, hormones such as glucocorticoids, mineralocorticoids, transforming growth factor β and mediators (cytokines) such as interleukin -6, stimulates SGK1 action. SGK1 gene expression is regulated by cellular signals involving cytosolic Ca2+, cyclic AMP (adenosine monophosphate), stress-activated protein kinase (SAPK2 (serine/threonine-protein kinase 2), p38 kinase), protein kinase C. Also, insulin and insulin-like growth factor, ERK (extracellular signal-regulated kinase) 1/2, and hepatic growth factor induces SGK1 transcription. Upregulation of SGK1 is observed in diabetes, liver cirrhosis, glomerulonephritis, dialysis and several tumors.

서열

Synthetic peptide located within the following region: ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

SGK1 inhibits PM2. 5-induced apoptosis and oxidative stress in human lung alveolar epithelial A549 cells.
Li J, et al.
Biochemical and Biophysical Research Communications, 496(4), 1291-1295 (2018)
Single nucleotide polymorphism microarray analysis in cortisol-secreting adrenocortical adenomas identifies new candidate genes and pathways.
Ronchi C L, et al.
Neoplasia, 14(3), 206-218 (2012)
Associations of the Serum/Glucocorticoid Regulated Kinase Genes With BP Changes and Hypertension Incidence: The Gensalt Study.
Zhang D, et al.
American Journal of Hypertension, 30(1), 95-101 (2016)
Lnc-SGK1 induced by Helicobacter pylori infection and highsalt diet promote Th2 and Th17 differentiation in human gastric cancer by SGK1/Jun B signaling.
Yao Y, et al.
Oncotarget, 7(15), 20549-20549 (2016)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.