SAB2107930

Anti-SCN5A antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-CDCD2, Anti-CMD1E, Anti-CMPD2, Anti-HB1, Anti-HB2, Anti-HBBD, Anti-HH1, Anti-ICCD, Anti-IVF, Anti-LQT3, Anti-Nav1.5, Anti-PFHB1, Anti-SSS1, Anti-VF1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 222kDa
• 종 반응성: guinea pig, human, mouse, horse, rat, dog, rabbit, bovine
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunoblotting: suitable
• NCBI 수납 번호: NM_000335
• UniProt 수납 번호: Q8IZC9
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SCN5A(6331)

설명

면역원

Synthetic peptide directed towards the C terminal region of human SCN5A

생화학적/생리학적 작용

SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The encoded protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in two transcript variants encoding separate isoforms which differ by a single amino acid. Mutation nomenclature has been assigned with respect to the longer isoform.

서열

Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable