콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

SAB2107115

Sigma-Aldrich

Anti-KRAS antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-C-K-RAS, Anti-CFC2, Anti-K-RAS2A, Anti-K-RAS2B, Anti-K-RAS4A, Anti-K-RAS4B, Anti-K-Ras, Anti-K-Ras 2, Anti-KRAS1, Anti-KRAS2, Anti-NS, Anti-NS3, Anti-OES, Anti-RALD, Anti-RASK2, Anti-c-Ki-ras, Anti-c-Ki-ras2

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

20 kDa

종 반응성

human, rabbit, bovine, rat, guinea pig, horse, dog, mouse

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... KRAS(3845)
rat ... Kras(24525)

면역원

The immunogen for anti-KRAS antibody: synthetic peptide derected towards the N terminal of human KRAS

생화학적/생리학적 작용

Kras is a oncogene and member of the small GTPase superfamily.

서열

Synthetic peptide located within the following region: QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Wulamujiang Aini et al.
Transplant immunology, 31(2), 55-59 (2014-07-06)
In living donor liver transplantation, the biological organ age of the donated allograft is unknown in young patients who receive grafts from older donors. Few studies have focused on the effects of aging on allografts in the state of tolerance.
Hua Yang et al.
Anti-cancer drugs, 25(7), 767-777 (2014-04-02)
Histone deacetylase inhibitors are a new class of anticancer agents that inhibit cancer cell proliferation and induce apoptosis and cell cycle arrest in various cancer cells. Recently, we identified ZYJ-34c, a modified histone deacetylase inhibitor that showed significantly higher antitumor
Maria Angelica Cortez et al.
Molecular therapy : the journal of the American Society of Gene Therapy, 22(8), 1494-1503 (2014-05-06)
The microRNA (miR)-200s and their negative regulator ZEB1 have been extensively studied in the context of the epithelial-mesenchymal transition. Loss of miR-200s has been shown to enhance cancer aggressiveness and metastasis, whereas replacement of miR-200 miRNAs has been shown to
Ki Hwan Kweon et al.
International journal of oncology, 45(5), 2065-2075 (2014-08-12)
Despite the favorable therapeutic outcomes reported in differentiated thyroid cancer (DTC), a significant proportion of DTC patients present with refractory behavior to conventional therapy. The sirtuin (Sirt) family has recently been implicated in the maintenance of cellular homeostasis under genotoxic
Joseph Carver et al.
PloS one, 9(8), e103836-e103836 (2014-08-06)
Mutations in the Ras family of small GTPases, particularly KRAS, occur at high frequencies in cancer and represent a major unmet therapeutic need due to the lack of effective targeted therapies. Past efforts directed at inhibiting the activity of the

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.