추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
22 kDa
종 반응성
rat, human, mouse, bovine, pig, horse, rabbit
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SNX10(29887)
mouse ... Snx10(71982)
관련 카테고리
일반 설명
Sorting nexin 10 (SNX10) is a transmembrane protein belonging to SNX family. SNX10 has phox domain which binds to phosphoinositide-binding domain. In human chromosome, the gene SNX10 is located on 7p15.2.
면역원
The immunogen for anti-SNX10 antibody: synthetic peptide derected towards the middle region of human SNX10
생화학적/생리학적 작용
Snx10 may be involved in several stages of intracellular trafficking. May play a role in endosome homeostasis. Overexpression causes formation of huge vacuoles. Mutations in SNX10 leads to autosomal recessive osteoporosis due to dysregulation of osteoclasts. SNX10 interaction with vacuolar-type H+ -ATPase (V-ATPase) complex initiates ciliogenesis, critical for early embryonic development.
서열
Synthetic peptide located within the following region: DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
SNX10 gene mutation leading to osteopetrosis with dysfunctional osteoclasts
Stattin EL, et al.
Scientific Reports, 7(1), 3012-3012 (2017)
A novel mutation in SNX10 gene causes malignant infantile Osteopetrosis
Amirfiroozy A, et al.
Avicenna Journal of Medical Biotechnology, 9(4), 205-205 (2017)
Ting Hu et al.
Folia neuropathologica, 59(4), 359-371 (2022-02-05)
Gliomas are the most seen tumours in adults in the central nervous system, and high grade of gliomas cause the worse prognose of patients with a shorter survival period. Ubiquitin-specific protease 38 (USP38) has been regarded as the negative regulator
Baoming Qin et al.
The Journal of biological chemistry, 281(48), 36891-36896 (2006-10-03)
Eukaryotic cells maintain a sophisticated network of intracellular membranous system to ensure the proper distribution and compartmentalization of cellular proteins critical for diverse functions such as cell division or cell-cell communication. Yet, little is known about the mechanism that regulates
Yanqun Chen et al.
Cell research, 22(2), 333-345 (2011-08-17)
Sorting nexins (SNXs) are phosphoinositide-binding proteins implicated in the sorting of various membrane proteins in vitro, but the in vivo functions of them remain largely unknown. We reported previously that SNX10 is a unique member of the SNX family genes
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.