SAB2106776

Anti-FTO antibody produced in rabbit

affinity isolated antibody

• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 58 kDa
• 종 반응성: human, dog, bovine, sheep, horse, pig, mouse, rat
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NM_011936
• UniProt 수납 번호: Q8BGW1
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... FTO(79068) ; mouse ... Fto(26383)

설명

면역원

Synthetic peptide directed towards the N terminal of human FTO

생화학적/생리학적 작용

Fto is a dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. Fto has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. Fto has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. Fto has no activity towards 1-methylguanine and no detectable activity towards double-stranded DNA. Fto requires molecular oxygen, alpha-ketoglutarate and iron. Fto contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. Fto contributes to the regulation of body size and body fat accumulation.

서열

Synthetic peptide located within the following region: MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable