SAB2106448

Anti-SIX1 antibody produced in rabbit

affinity isolated antibody

• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 32 kDa
• 종 반응성: human, guinea pig, rat, dog, horse, mouse, bovine, sheep, rabbit
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NM_009189
• UniProt 수납 번호: Q62231
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SIX1(6495) ; mouse ... Six1(20471)

설명

일반 설명

Sine oculis homeobox homolog 1 (SIX1) is a transcription factor, having a homeodomain. It is part of the homeoprotein family and is expressed during embryogenesis. The gene encoding this protein is localized on human chromosome 14q23.1.

면역원

The immunogen for anti-SIX1 antibody: synthetic peptide derected towards the N terminal of human SIX1

생화학적/생리학적 작용

Sine oculis homeobox homolog 1 (SIX1) enhances the rate of proliferation of cells and their survival. It has a role in organogenesis and has been linked to several malignancies.

서열

Synthetic peptide located within the following region: ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable