SAB2106245

Anti-PDX1 antibody produced in rabbit

affinity isolated antibody

• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 31 kDa
• 종 반응성: rat, human, dog, rabbit, bovine, mouse, horse
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NM_008814
• UniProt 수납 번호: P52946
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... PDX1(3651) ; mouse ... Pdx1(18609)

설명

면역원

The immunogen for anti-PDX1 antibody: synthetic peptide derected towards the N terminal of human PDX1

생화학적/생리학적 작용

Pdx1 activates insulin and somatostatin gene transcription. It is a key regulator of islet peptide hormone expression but also responsible for the development of the pancreas, most probably by determining maturation and differentiation of common pancreatic precursor cells in the developing gut. It binds the DNA sequence 5′-CC[CT]TAATGGG-3′.

서열

Synthetic peptide located within the following region: LYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHH

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable