SAB2105635

Anti-TGFB2 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-MGC116892, Anti-TGF-beta2
• MDL number: MFCD03456059
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 46 kDa
• 종 반응성: rat, pig, human, dog, rabbit, mouse, bovine, horse, sheep
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NM_003238
• UniProt 수납 번호: P61812
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... TGFB2(7042)

설명

면역원

Synthetic peptide directed towards the middle region of human TGFB2

생화학적/생리학적 작용

This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters′ anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified.

서열

Synthetic peptide located within the following region: NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable