추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
7 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TFF1(7031)
일반 설명
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.
Trefoil factor 1 (TFF1) also known as breast cancer estrogen-inducible protein (BCEI) and pS2 protein, is highly expressed in the gastrointestinal mucosa. The protein was first characterized in the breast cancer cell line MCF-7. The gene TFF1 is localized on human chromosome 21q22.3.
면역원
Synthetic peptide directed towards the middle region of human TFF1
생화학적/생리학적 작용
The major functions of TFF1 are mucosal repair incase of damage and maintenance of mucosal integrity. TFF1 promotes cell migration in breast cancer cells in response to estrogen. TFF1 is a tumour suppressor gene in gastric cancer and the mutation of which leads to development and progression of gastric cancer. TFF1 is an important marker in lobular endocervical glandular hyperplasia. TFF1 is a potent inhibitor of growth of calcium oxalate crystal growth in renal tubules.
서열
Synthetic peptide located within the following region: PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Identification of human urinary trefoil factor 1 as a novel calcium oxalate crystal growth inhibitor
Chutipongtanate S, et al.
The Journal of Clinical Investigation, 115(12), 3613-3622 (2005)
The pS2/TFF1 trefoil factor, from basic research to clinical applications
Ribieras ST, et al.
Biochimica et Biophysica Acta - Reviews on Cancer, 1378(1), F61-F77 (1998)
Loss of heterozygosity and promoter methylation, but not mutation, may underlie loss of TFF1 in gastric carcinoma
Carvalho R, et al.
Laboratory Investigation; a Journal of Technical Methods and Pathology, 82(10), 1319-1326 (2002)
The three human trefoil genes TFF1, TFF2, and TFF3 are located within a region of 55 kb on chromosome 21q22. 3
Seib T, et al.
Genomics, 40(1), 200-202 (1997)
The estrogen-regulated protein, TFF1, stimulates migration of human breast cancer cells
Prest SJ, et al.
Faseb Journal, 16(6), 592-594 (2002)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.