콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

SAB2102177

Sigma-Aldrich

Anti-SLC22A6 (ab2) antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-HOAT1, Anti-MGC45260, Anti-OAT1, Anti-PAHT, Anti-Solute carrier family 22 (organic anion transporter), member 6

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

62 kDa

종 반응성

mouse, guinea pig, human, horse, rat, bovine, rabbit, dog

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SLC22A6(9356)

일반 설명

Solute carrier family 22 member 6 (SLC22A6) belongs to organic anion transporter-1 family. The protein is expressed in kidney and brain. The gene is located on human chromosome 11q12.3.

면역원

Synthetic peptide directed towards the N terminal region of human SLC22A6

생화학적/생리학적 작용

Solute carrier family 22 member 6 (SLC22A6) is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.
SLC22A6 regulates the body disposition of a variety of clinically important drugs, such as, anti-HIV therapeutics, antitumor drugs, antibiotics, antihypertensives and anti-inflammatories. Ubiquitination sites of SLC22A6 is involved in the protein kinase C (PKC)-mediated endocytosis of the transporter. It plays an important role in substrate recognition.

서열

Synthetic peptide located within the following region: AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Functional role of the C terminus of human organic anion transporter hOAT1
Xu W, etal.
The Journal of Biological Chemistry, 281(42), 31178-31183 (2006)
Organic anion transporter OAT1 undergoes constitutive and protein kinase C-regulated trafficking through a dynamin-and clathrin-dependent pathway
Zhang Q, et al.
The Journal of Biological Chemistry (2008)
Three ubiquitination sites of organic anion transporter-1 synergistically mediate protein kinase C-dependent endocytosis of the transporter
Li S, et al.
Molecular Pharmacology, mol-113 (2013)
Navaz Karimian Pour et al.
Pharmaceutics, 11(12) (2019-11-27)
Inflammation impacts the expression and function of drug transporters at term-gestation; however, the impact of inflammation on the expression of drug transporters at mid-gestation is largely unknown. Since renal drug transporters play a key role in the clearance of many
Josefin A Jacobsson et al.
Genomics, 90(5), 595-609 (2007-08-24)
The solute carrier family 22 (SLC22) is a large family of organic cation and anion transporters. These are transmembrane proteins expressed predominantly in kidneys and liver and mediate the uptake and excretion of environmental toxins, endogenous substances, and drugs from

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.