추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
51 kDa
종 반응성
dog, human, rabbit, guinea pig, bovine
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... FLI1(2313)
관련 카테고리
일반 설명
Fli-1 proto-oncogene, ETS transcription factor (FLI1) is encoded by the gene mapped to human chromosome 11. The encoded protein belongs to the ETS family of transcription factors. FLI1 consists of ETS DNA-binding domain at its C-terminal end and is mainly expressed in hematopoietic and vascular endothelial cells.
면역원
Synthetic peptide directed towards the middle region of human FLI1
애플리케이션
Anti-FLI1 antibody produced in rabbit has been used in chromatin immunoprecipitation.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Chromatin immunoprecipitation (1 paper)
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Chromatin immunoprecipitation (1 paper)
Chromatin immunoprecipitation (1 paper)
생화학적/생리학적 작용
Fli-1 proto-oncogene, ETS transcription factor (FLI1) acts as a sequence-specific transcriptional activator. It might be implicated in the development of both the haematopoietic and vascular systems. In addition, it also plays a vital role in megakaryopoiesis and platelet function. FLI1 functions as a regulator of essential midkine (MK) genes. Mutations in FLI1 is associated with the pathogenesis of Paris-Trousseau syndrome and congenital thrombocytopenia.
서열
Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
The Fli-1 proto-oncogene, involved in erythroleukemia and Ewing's sarcoma, encodes a transcriptional activator with DNA-binding specificities distinct from other Ets family members.
Zhang L
Oncogene, 8(6), 1621-1630 (1993)
Marco Fidaleo et al.
Oncotarget, 6(31), 31740-31757 (2015-10-10)
Alternative splicing plays a key role in the DNA damage response and in cancer. Ewing Sarcomas (ES) are aggressive tumors caused by different chromosomal translocations that yield in-frame fusion proteins driving transformation. RNA profiling reveals genes differentially regulated by UV
EWS, but not EWS-FLI-1, is associated with both TFIID and RNA polymerase II: interactions between two members of the TET family, EWS and hTAFII68, and subunits of TFIID and RNA polymerase II complexes.
Bertolotti A
Molecular and Cellular Biology, 18(3), 1489-1497 (1998)
Macrothrombocytopenia and dense granule deficiency associated with FLI1 variants: ultrastructural and pathogenic features.
Saultier P
Haematologica, 102(6), 1006-1016 (2017)
Molecular characterization of an 11q interstitial deletion in a patient with the clinical features of Jacobsen syndrome.
Wenger SL
American Journal of Medical Genetics. Part A, 140(7), 704-708 (2006)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.