추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
29 kDa
종 반응성
pig, human, dog, bovine, sheep, horse
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CD40LG(959)
면역원
Synthetic peptide directed towards the middle region of human CD40LG
생화학적/생리학적 작용
CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1375 BC071754.1 1-1375 1376-1599 X67878.1 1349-1572 1600-1834 BC071754.1 1596-1830
서열
Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Nidhi Anil et al.
Immunological investigations, 43(6), 535-543 (2014-03-26)
Cystic fibrosis (CF) lung disease is characterized by dysregulated inflammatory response in the airways. CD4(+)CD25(+) regulatory T cells play a crucial role in maintaining the immune homeostasis. However their role in the disease pathogenesis of CF remains unexplored. To determine
Laurent Muller et al.
Journal of immunological methods, 411, 55-65 (2014-06-22)
Effects of exosomes present in human plasma on immune cells have not been examined in detail. Immunological studies with plasma-derived exosomes require their isolation by procedures involving ultracentrifugation. These procedures were largely developed using supernatants of cultured cells. To test
Janine Bleil et al.
Arthritis & rheumatology (Hoboken, N.J.), 66(7), 1745-1754 (2014-02-28)
To unravel the mechanisms that control bony ankylosis in ankylosing spondylitis (AS). Histomorphologic and histomorphometric analyses were performed on zygapophyseal joints obtained from 18 patients with AS, 9 patients with osteoarthritis (OA), and 10 cadaver donors without a rheumatic disease
Ryan Flynn et al.
Blood, 123(25), 3988-3998 (2014-05-14)
Chronic graft-versus-host disease (cGVHD) is a leading cause of morbidity and mortality after allogeneic hematopoietic stem cell transplantation. Having shown that germinal center (GC) formation and immunoglobulin deposition are required for multiorgan system cGVHD and associated bronchiolitis obliterans syndrome (BOS)
Natural killer T cells are essential for the development of contact hypersensitivity in BALB/c mice.
Chihiro Shimizuhira et al.
The Journal of investigative dermatology, 134(11), 2709-2718 (2014-04-24)
Contact hypersensitivity (CHS) has been widely used to study cutaneous immune responses, as a prototype of delayed-type hypersensitivity. Although natural killer T (NKT) cells have been assumed to have an important role in CHS, their role is controversial. Here, we
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.