SAB1412489

ANTI-DLX5 antibody produced in mouse

clone 1B7, purified immunoglobulin, buffered aqueous solution

• 동의어(들): DLX5
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1B7, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen 37.84 kDa
• 종 반응성: human
• 기술: immunohistochemistry: suitable; indirect ELISA: suitable
• 동형: IgG2bκ
• NCBI 수납 번호: NM_005221
• UniProt 수납 번호: P56178
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DLX5(1749)

설명

일반 설명

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. (provided by RefSeq)

면역원

DLX5 (NP_005212, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR*

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable