SAB1412479

ANTI-FOXC2 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

• 동의어(들): FKHL14, FOXC2, LD, MFH-1, MFH1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1D4, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen 36.74 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_005251
• UniProt 수납 번호: Q99958
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... FOXC2(2303)

설명

일반 설명

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. (provided by RefSeq)

면역원

FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable