SAB1412382

ANTI-RETN antibody produced in mouse

clone 6C3, purified immunoglobulin, buffered aqueous solution

• 동의어(들): ADSF, FIZZ3, MGC126603, MGC126609, RETN
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 6C3, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen 35.2 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: NM_020415
• UniProt 수납 번호: Q9HD89
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RETN(56729)

설명

일반 설명

This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. (provided by RefSeq)

면역원

RETN (NP_065148, 20 a.a. ~ 106 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV*

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable