SAB1412336

ANTI-BRAF antibody produced in mouse

clone 1H7, purified immunoglobulin, buffered aqueous solution

• 동의어(들): B-RAF1, BRAF, BRAF1, FLJ95109, MGC126806
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1H7, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen 35.97 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_004333
• UniProt 수납 번호: P15056
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... BRAF(673)

설명

일반 설명

This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene. (provided by RefSeq)

면역원

BRAF (NP_004324, 138 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVP

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable