SAB1412166

ANTI-PAX8 antibody produced in mouse

clone 3G11, purified immunoglobulin, buffered aqueous solution

• 동의어(들): PAX8
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3G11, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen 34.32 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2bκ
• NCBI 수납 번호: NM_003466
• UniProt 수납 번호: Q06710
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PAX8(7849)

설명

일반 설명

This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternateively spliced transcript variants encoding different isoforms have been described. (provided by RefSeq)

면역원

PAX8 (NP_003457, 300 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPH

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable