SAB1411911

ANTI-EPHA5 antibody produced in mouse

clone 6F4, purified immunoglobulin, buffered aqueous solution

• 동의어(들): CEK7, EHK1, EPHA5, HEK7, TYRO4
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 6F4, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen 36.63 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• NCBI 수납 번호: NM_004439
• UniProt 수납 번호: P54756
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... EPHA5(2044)

설명

일반 설명

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

면역원

EPHA5 (NP_004430, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable