추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
antigen 29.6 kDa
종 반응성
human, mouse
기술
western blot: 1 μg/mL
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... NNMT(4837)
일반 설명
The nicotinamide N-methyltransferase (NNMT) gene, spanning 16.5kb of genomic DNA with three exons and two introns, is mapped to human chromosome 11q23.1. The encoded protein consists of 264 amino acids with a predicted molecular mass of 29.6kDa. NNMT is expressed in cytoplasm.
면역원
NNMT (NP_006160.1, 1 a.a. ~ 264 a.a) full-length human protein.
Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
생화학적/생리학적 작용
Nicotinamide N-methyltransferase (NNMT) is a cytosolic methyltransferase enzyme. It catalyzes the N-methylation of nicotinamide, pyridines and other structural analogs. Hence, it plays a vital role in the biotransformation and detoxification of various xenobiotic compounds. Altered expression of the gene is associated with the pathogenesis of various diseases such as acute lymphoblastic leukemia (ALL), parkinson′s disease, thyroid cancer, gastric cancer, colorectal cancer, lung, liver and oral carcinomas. In addition, variation in the gene might increase the risk of susceptibility to hyperlipidemia and migraine.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Nicotinamide-N-Methyltransferase gene rs694539 variant and migraine risk.
Sazci A
The Journal of Headache and Pain, 17 (2016)
NNMT (nicotinamide N-methyltransferase)
Emanuelli M
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2009)
Physiological Study on Association between Nicotinamide N-Methyltransferase Gene Polymorphisms and Hyperlipidemia.
Zhu XJ
BioMed Research International (2016)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.