SAB1409948

Monoclonal Anti-CDKL1 antibody produced in mouse

clone 8B2, ascites fluid, solution

• 동의어(들): KKIALRE, p42
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: ascites fluid
• 항체 생산 유형: primary antibodies
• 클론: 8B2, monoclonal
• 형태: solution
• 분자량: antigen 36.63 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1:500-1:1000
• 동형: IgG2bκ
• NCBI 수납 번호: NM_004196
• UniProt 수납 번호: Q00532
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CDKL1(8814)

설명

일반 설명

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Alternative splice variants encoding different protein isoforms have been described, but their full-length nature has not been determined. (provided by RefSeq)

면역원

CDKL1 (NP_004187, 259 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI

물리적 형태

Clear solution

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable