추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
antigen 26.8 kDa
종 반응성
human
기술
western blot: 1 μg/mL
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CIDEC(63924)
일반 설명
DNA fragmentation factor (DFF) induces the fragmentation of DNA associated with apoptosis. A novel family of cell death-inducing DFF45 (MIM 601882)-like effectors (CIDEs), including CIDEC, can also promote apoptosis (Liang et al., 2003 [PubMed 12429024]).[supplied by OMIM
면역원
CIDEC (NP_071377.2, 1 a.a. ~ 238 a.a) full-length human protein.
Sequence
MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
Sequence
MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
생화학적/생리학적 작용
Cell death-inducing DFFA-like effector protein C (CIDEC) has a role in the differentiation of adipocytes. It associates with 5′ adenosine monophosphate-activated protein kinase (AMPK) α subunit 1 and acts as a negative regulator of the AMPK complex. CIDEC is also involved in lipid storage and it modulates the size of lipid droplets. The protein has been linked to obesity.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Yuqiao Xu et al.
Biochimica et biophysica acta, 1850(12), 2552-2562 (2015-09-15)
We previously showed that Cidec was localized on the surface of lipid droplets and could promote the differentiation of human adipocytes, but the molecular mechanism was still unknown. In this study, we first sought to identify proteins that interact with
Seung Mi Lee et al.
Biochemical and biophysical research communications, 439(4), 564-569 (2013-09-13)
FSP27 (CIDE-3 in humans) plays critical roles in lipid metabolism and apoptosis and is known to be involved in regulation of lipid droplet (LD) size and lipid storage and apoptotic DNA fragmentation. Given that CIDE-containing proteins including FSP27 are associated
Z Q Wang et al.
International journal of obesity (2005), 34(9), 1355-1364 (2010-05-05)
It has been well documented that human adenovirus type 36 (Ad-36) is associated with obesity. However, the underlying molecular mechanism of Ad-36 inducing obesity remains unknown. We sought to investigate the effect of Ad-36 infection on Cidec, AMPK pathway and
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.