SAB1409345

Monoclonal Anti-NDUFS4 antibody produced in mouse

clone 3A4, ascites fluid, solution

• 동의어(들): AQDQ
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: ascites fluid
• 항체 생산 유형: primary antibodies
• 클론: 3A4, monoclonal
• 형태: solution
• 분자량: antigen 44.99 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgMκ
• NCBI 수납 번호: BC005270
• UniProt 수납 번호: O43181
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NDUFS4(4724)

설명

일반 설명

This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes. (provided by RefSeq)

면역원

NDUFS4 (AAH05270, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

물리적 형태

Clear solution

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable