SAB1407998

Anti-PHF17 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• 동의어(들): FLJ22479, JADE1, KIAA1807
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~58.4 kDa
• 종 반응성: human
• 기술: indirect immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI 수납 번호: NM_024900
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PHF17(79960)

설명

일반 설명

Mouse polyclonal antibody raised against a full-length human PHF17 protein.

PHF17 (PHD finger protein 17) is a short-lived, kidney-enriched Jade protein consisting of canonical plant homeodomain (PHD) finger protein and a non-canonical extended PHD with zinc-binding ability. It is localized in the nucleus and is highly expressed in the kidney and renal proximal tubule cells.

면역원

PHF17 (NP_079176.2, 1 a.a. ~ 509 a.a) full-length human protein.

Sequence
MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLERVMIDTDTL

애플리케이션

Anti-PHF17 antibody produced in mouse is suitable for indirect immunofluorescence and western blot analysis.

생화학적/생리학적 작용

PHF17 (PHD finger protein 17) is associated with several cellular activities such as chromatin remodeling, renal tubular epithelial cell differentiation, growth suppression, apoptosis and protein-protein interactions. It possesses transcriptional and endogenous histone acetyltransferase (HAT) activity. It acts as a transcriptional co-activator in the TIP60 mediated histone H4/H2A specific HAT activity. It has been reported that PHF17 may play a role in the renal cancer and von Hippel-Lindau disease. PHF17 also possesses tumour suppressor property. In the renal tumorigenesis, it controls canonical Wnt signaling pathway by ubiquitylating oncoprotein β-catenin in Wnt-responsive manner.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable