SAB1406659

Anti-SPOP antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• 동의어(들): TEF2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~42.1 kDa
• 종 반응성: human
• 기술: indirect immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI 수납 번호: NM_001007226.1
• UniProt 수납 번호: O43791
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SPOP(8405)

설명

일반 설명

Speckle type BTB/POZ protein (SPOP) is encoded by the gene mapped to human chromosome 17q21.33. The encoded protein is characterized with a substrate-binding MATH (meprin and TRAF-C homology) domain at the N-terminal and a CUL3-binding BTB domain at the C-terminal end.

This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. (provided by RefSeq)

면역원

SPOP (NP_001007227.1, 1 a.a. ~ 374 a.a) full-length human protein.

Sequence
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

애플리케이션

Tissue microarray (TMA).

생화학적/생리학적 작용

Peckle type BTB/POZ protein (SPOP) activates β-catenin/ transcription factor 4 (TCF-4) complex and stimulates tumor progression in clear cell renal cell carcinoma. The encoded protein ubiquitinates various substrates in Drosophila and human, including puckered (Puc), cubitus interruptus (Ci) / glioblastoma (Gli), macroH2A, death-associated protein 6 (DAXX) and steroid receptor coactivator (SRC)-3. It acts as a potential tumor suppressor for various cancers including breast cancer. Mutation in the gene is associated with the development of human prostate cancers.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable