SAB1406282

Anti-PPP1CB antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• 동의어(들): MGC3672, PP-1B, PPP1CD
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~37.2 kDa
• 종 반응성: human
• 기술: western blot: 1 μg/mL
• NCBI 수납 번호: NM_002709.2
• UniProt 수납 번호: P62140
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PPP1CB(5500)

설명

일반 설명

Protein phosphatase 1 catalytic subunit β (PPP1CB), is encoded by the gene mapped to human chromosome 2p23.2. The protein is expressed in spines, dendrites, axon terminals, axons, and glia in the prefrontal cortex, but at higher levels in dendrites. PPP1CB is characterized with a calcineurin-like phosphoesterase domain, a metallophosphatase domain and a serine/threonine protein phosphatase domain.

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. (provided by RefSeq)

면역원

PPP1CB (NP_002700.1, 1 a.a. ~ 327 a.a) full-length human protein.

Sequence
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

생화학적/생리학적 작용

Protein phosphatase 1 catalytic subunit β (PPP1CB) plays a vital role in various cellular processes, such as cell adhesion, cell cycle, small GTPase-mediated signal transduction, protein dephosphorylation, negative regulation of transforming growth factor, regulation of glycogen catabolic process and striated muscle tissue development. In brain, PPP1CB regulates synaptic plasticity. Mutation in the gene causes intellectual disability (ID), congenital heart disease. In addition, variation in the gene expression is also associated with the development of features resembling noonan syndrome with loose anagen hair (NS-LAH).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable