SAB1404503

Monoclonal Anti-TYMS antibody produced in mouse

clone 2B2, purified immunoglobulin, buffered aqueous solution

• 동의어(들): HsT422, MGC88736, TMS, TS, TSase
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2B2, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~37.11 kDa
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• NCBI 수납 번호: BC013919
• UniProt 수납 번호: P04818
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TYMS(7298)

설명

일반 설명

The gene encoding thymidylate synthetase (TYMS) is localized on human chromosome 18p11.32.

면역원

TYMS (AAH13919, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC

생화학적/생리학적 작용

Thymidylate synthetase (TYMS) has a role in DNA replication and thymidylate biosynthesis. It is also involved in cell survival and proliferation. TYMS takes part in folate metabolism. The protein methylates deoxyuridylate to deoxythymidylate.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable