SAB1404372

Monoclonal Anti-SKP1A, (C-terminal) antibody produced in mouse

clone 2E6, purified immunoglobulin, buffered aqueous solution

• 동의어(들): EMC19, MGC34403, OCP-II, OCP2, SKP1A, TCEB1L, p19A
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: ELISA (i); IF; WB
• 클론: 2E6, monoclonal
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2E6, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~37.99 kDa
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_006930
• UniProt 수납 번호: P63208
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SKP1(6500)

설명

일반 설명

This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. (provided by RefSeq)

면역원

SKP1A (NP_008861, 53 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable