SAB1404315

Monoclonal Anti-RGS13 antibody produced in mouse

clone 1D5, purified immunoglobulin, buffered aqueous solution

• 동의어(들): MGC17173
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: ELISA (i)
• 클론: 1D5, monoclonal
• 종 반응성: human
• 기술: indirect ELISA: suitable

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1D5, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~43.6 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: BC016667
• UniProt 수납 번호: O14921
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RGS13(6003)

설명

일반 설명

The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist. (provided by RefSeq)

면역원

RGS13 (AAH16667, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable