SAB1404211

Monoclonal Anti-PKLR, (C-terminal) antibody produced in mouse

clone 4E12, purified immunoglobulin, buffered aqueous solution

• 동의어(들): PK1, PKL, PKR, PKRL, RPK
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: ELISA (i)
• 클론: 4E12, monoclonal
• 종 반응성: human
• 기술: indirect ELISA: suitable

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 4E12, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~36.01 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2bκ
• NCBI 수납 번호: BC025737
• UniProt 수납 번호: P30613
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PKLR(5313)

설명

일반 설명

The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

면역원

PKLR (AAH25737, 485 a.a. ~ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable