SAB1403700

Monoclonal Anti-CRYM, (C-terminal) antibody produced in mouse

clone 1C6, purified immunoglobulin, buffered aqueous solution

• 동의어(들): DFNA40, THBP
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1C6, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~37.11 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• NCBI 수납 번호: NM_001888
• UniProt 수납 번호: Q14894
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CRYM(1428)

설명

일반 설명

Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Multiple alternatively spliced transcript variants have been found for this gene. (provided by RefSeq)

면역원

CRYM (NP_001879, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable