추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
ascites fluid
항체 생산 유형
primary antibodies
클론
8C11, monoclonal
분자량
antigen ~38.21 kDa
종 반응성
human
기술
indirect ELISA: suitable
western blot: 1:500-1:1000
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MUC5B(727897)
관련 카테고리
일반 설명
Mucin 5B (MUC5B) is a high molecular mass, heavily O-glycosylated gel-forming mucin. It is encoded by the gene mapped to human chromosome 11p15.5. MUC5B is found in bronchus glands, submaxillary glands, endocervix, gall bladder, and pancreas.
면역원
MUC5B (XP_039877.9, 4186 a.a. ~ 4295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV
Sequence
CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV
애플리케이션
Monoclonal Anti-MUC5B antibody produced in mouse has been used in immunofluorescence .
생화학적/생리학적 작용
MUC5B is salivary mucin that might contribute to the lubrication, hydration, pathogen exclusion, and viscoelastic properties of the whole saliva. The protein acts as a marker of mucous gland cells. Mouse MUC5B plays a vital role in maintaining immune homeostasis in the lungs. It is also involved in preventing infections in the airways and middle ear by facilitating mucociliary clearance (MCC). Mutation in the MUC5B gene leads to the development of idiopathic pulmonary fibrosis. Overexpression of the gene stimulates aggressive behavior of breast cancer MCF7 cells.
물리적 형태
Clear solution
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
11 - Combustible Solids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
시험 성적서(COA)
Lot/Batch Number
Hélène Valque et al.
PloS one, 7(10), e46699-e46699 (2012-10-12)
The mucin MUC5B has a critical protective function in the normal lung, salivary glands, esophagus, and gallbladder, and has been reported to be aberrantly expressed in breast cancer, the second leading cause of cancer-related deaths among women worldwide. To understand
Shinji Sumiyoshi et al.
Lung cancer (Amsterdam, Netherlands), 84(3), 281-288 (2014-04-15)
The characteristics of non-terminal respiratory unit (TRU) type lung adenocarcinoma are still unclear. The aim of the present study was to characterize non-TRU type lung adenocarcinoma. We analyzed the expression of mucins MUC5B and MUC5AC, as well as thyroid transcription
Grant E Duclos et al.
Science advances, 5(12), eaaw3413-eaaw3413 (2019-12-18)
The human bronchial epithelium is composed of multiple distinct cell types that cooperate to defend against environmental insults. While studies have shown that smoking alters bronchial epithelial function and morphology, its precise effects on specific cell types and overall tissue
Lina M Salazar-Peláez et al.
PloS one, 10(3), e0119717-e0119717 (2015-03-15)
Vitronectin, a multifunctional glycoprotein, is involved in coagulation, inhibition of the formation of the membrane attack complex (MAC), cell adhesion and migration, wound healing, and tissue remodeling. The primary cellular source of vitronectin is hepatocytes; it is not known whether
Heather S Davies et al.
PloS one, 9(9), e108372-e108372 (2014-09-30)
The salivary mucins that include MUC5B (gel-forming) and MUC7 (non-gel-forming) are major contributors to the protective mucus barrier in the oral cavity, and it is possible that dietary components may influence barrier properties. We show how one dietary compound, the
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.