SAB1403345

Monoclonal Anti-KIF9, (C-terminal) antibody produced in mouse

clone 4E9, purified immunoglobulin, buffered aqueous solution

• 동의어(들): MGC104186
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 4E9, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~37 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_182902
• UniProt 수납 번호: Q9HAQ2
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... KIF9(64147)

설명

일반 설명

KIF9 (Kinesin family member 9) is a microtubule-associated protein belonging to the kinesin 9 motor family. It is localized in the mitotic spindle.

Mouse monoclonal antibody raised against a partial recombinant KIF9.

면역원

KIF9 (NP_878905.1, 691 a.a. ~ 789 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR

애플리케이션

Monoclonal Anti-KIF9, (C-terminal) antibody produced in mouse is suitable for western blot and indirect ELISA.

생화학적/생리학적 작용

KIF9 (Kinesin family member 9) is involved in the regulation of spindle dynamics In terms of chromosome organization, spindle length control, and mitotic progression. It forms a complex by binding to the GEM, a small GTP-binding protein, in mitotic cells and the complex controls spindle length. It also retards microtubule growth. In primary macrophage of humans, KIF9 controls morphology and numbers of the podosomes and its ability to degrade matrix material.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable