SAB1402314

Monoclonal Anti-PMP22 antibody produced in mouse

clone 3G10, purified immunoglobulin, buffered aqueous solution

• 동의어(들): CMT1A, CMT1E, DSS, GAS-3, HMSNIA, HNPP, MGC20769, Sp110
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3G10, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~35.9 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2bκ
• NCBI 수납 번호: BC019040
• UniProt 수납 번호: Q01453
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PMP22(5376)

설명

일반 설명

This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing of this gene results in three transcript variants that encode the same protein. (provided by RefSeq)

면역원

PMP22 (AAH19040, 25 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA

생화학적/생리학적 작용

Peripheral myelin protein 22 (PMP22) plays a vital role in myelination during peripheral nerve development. It also has a role in cell-cell interactions, cell proliferation, maintenance of axons and the determination of myelin thickness and stability. Aberrations or mutations in the PMP22 gene lead to heritable demyelinating peripheral neuropathies, such as Charcot-Marie-tooth disease type IA (CMT1A) and Dejerine-Sottas syndrome. Overexpression of PMP22 might contribute to the development of chronic myeloid leukemia (CML).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable